Lineage for d4o5tb1 (4o5t B:2-327)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065620Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2065621Family b.68.6.1: SGL-like [63830] (4 protein domains)
  6. 2065652Protein automated matches [190602] (2 species)
    not a true protein
  7. 2065653Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries)
  8. 2065667Domain d4o5tb1: 4o5t B:2-327 [263251]
    Other proteins in same PDB: d4o5tb2
    automated match to d4o5sa_
    complexed with xda

Details for d4o5tb1

PDB Entry: 4o5t (more details), 2.9 Å

PDB Description: crystal structure of diels-alderase ce20 in complex with a product analog
PDB Compounds: (B:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d4o5tb1:

Sequence, based on SEQRES records: (download)

>d4o5tb1 b.68.6.1 (B:2-327) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
eipvieplftkmtedipgatgpvfdkngdfyvvasplsealinanslaeayearsdagei
lhidlktgkktvickpevngyggspigcqcdrdanqlfvadmrlgllvvqtdgtfeeian
kdsegrcmqgcaycafdyegnlwitapaggvapadftislrekfgsiycfttdgqmiqvd
tafqcpagiavrhmndgrpyqlivaeqptkklwsydikgpanienkkvwghipgthkgga
agmvfdednnllvanwgsshievfgpdggqpkmrircpfekpanlhfkpqtktifvtehd
nnavwkfewqrngkkqycetskfgif

Sequence, based on observed residues (ATOM records): (download)

>d4o5tb1 b.68.6.1 (B:2-327) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
eipvieplftkmtedipgatgpvfdkngdfyvvasplsealinanslaeaysdageilhi
dlktgkktvickpevngyggspigcqcdrdanqlfvadmrlgllvvqtdgtfeeiankds
egrcmqgcaycafdyegnlwitapaggvapadftislrekfgsiycfttdgqmiqvdtaf
qcpagiavrhmndgrpyqlivaeqptkklwsydikgpanienkkvwghipgthkggaagm
vfdednnllvanwgsshievfgpdggqpkmrircpfekpanlhfkpqtktifvtehdnna
vwkfewqrngkkqycetskfgif

SCOPe Domain Coordinates for d4o5tb1:

Click to download the PDB-style file with coordinates for d4o5tb1.
(The format of our PDB-style files is described here.)

Timeline for d4o5tb1:

  • d4o5tb1 first appeared in SCOPe 2.05, called d4o5tb_

View in 3D
Domains from same chain:
(mouse over for more information)
d4o5tb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4o5ta_