![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) ![]() |
![]() | Family b.68.6.1: SGL-like [63830] (4 proteins) |
![]() | Protein automated matches [190602] (2 species) not a true protein |
![]() | Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries) |
![]() | Domain d4o5sb_: 4o5s B: [263250] automated match to d4o5sa_ |
PDB Entry: 4o5s (more details), 1.8 Å
SCOPe Domain Sequences for d4o5sb_:
Sequence, based on SEQRES records: (download)
>d4o5sb_ b.68.6.1 (B:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]} eipvieplftkmtedipgatgpvfdkngdfyvvasplsealtkanspaeaykasrgagei lhidlktgkktvickpevngyggspigcqcdrdanqlfvadmrlgllvvqtegtfeeiak kdsegrcmqgcaycafdyegnlwitapaggvapadftislrekfgsiycfttdgqmiqvd tafqcpagiavrhmndgrpyqlivaeqptkklwsydikgpanienkkvwghipgthkgga agmvfdednnllvanwgsshievfgpdggqpkmrircpfekpanlhfkpqtktifvtehd nnavwkfewqrngkkqycetsk
>d4o5sb_ b.68.6.1 (B:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]} eipvieplftkmtedipgatgpvfdkngdfyvvasplsealtksrgageilhidlktgkk tvickpevngyggspigcqcdrdanqlfvadmrlgllvvqtegtfeeiakkdsegrcmqg caycafdyegnlwitapaggvapadftislrekfgsiycfttdgqmiqvdtafqcpagia vrhmndgrpyqlivaeqptkklwsydikgpanienkkvwghipgthkggaagmvfdednn llvanwgsshievfgpdggqpkmrircpfekpanlhfkpqtktifvtehdnnavwkfewq rngkkqycetsk
Timeline for d4o5sb_: