Lineage for d4o5sb_ (4o5s B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398879Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2398880Family b.68.6.1: SGL-like [63830] (4 protein domains)
  6. 2398911Protein automated matches [190602] (2 species)
    not a true protein
  7. 2398912Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries)
  8. 2398924Domain d4o5sb_: 4o5s B: [263250]
    automated match to d4o5sa_

Details for d4o5sb_

PDB Entry: 4o5s (more details), 1.8 Å

PDB Description: crystal structure of diels-alderase ce11
PDB Compounds: (B:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d4o5sb_:

Sequence, based on SEQRES records: (download)

>d4o5sb_ b.68.6.1 (B:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
eipvieplftkmtedipgatgpvfdkngdfyvvasplsealtkanspaeaykasrgagei
lhidlktgkktvickpevngyggspigcqcdrdanqlfvadmrlgllvvqtegtfeeiak
kdsegrcmqgcaycafdyegnlwitapaggvapadftislrekfgsiycfttdgqmiqvd
tafqcpagiavrhmndgrpyqlivaeqptkklwsydikgpanienkkvwghipgthkgga
agmvfdednnllvanwgsshievfgpdggqpkmrircpfekpanlhfkpqtktifvtehd
nnavwkfewqrngkkqycetsk

Sequence, based on observed residues (ATOM records): (download)

>d4o5sb_ b.68.6.1 (B:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
eipvieplftkmtedipgatgpvfdkngdfyvvasplsealtksrgageilhidlktgkk
tvickpevngyggspigcqcdrdanqlfvadmrlgllvvqtegtfeeiakkdsegrcmqg
caycafdyegnlwitapaggvapadftislrekfgsiycfttdgqmiqvdtafqcpagia
vrhmndgrpyqlivaeqptkklwsydikgpanienkkvwghipgthkggaagmvfdednn
llvanwgsshievfgpdggqpkmrircpfekpanlhfkpqtktifvtehdnnavwkfewq
rngkkqycetsk

SCOPe Domain Coordinates for d4o5sb_:

Click to download the PDB-style file with coordinates for d4o5sb_.
(The format of our PDB-style files is described here.)

Timeline for d4o5sb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4o5sa_