![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.82.1: ALDH-like [53720] (3 families) ![]() binds NAD differently from other NAD(P)-dependent oxidoreductases |
![]() | Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
![]() | Protein automated matches [190683] (61 species) not a true protein |
![]() | Species Burkholderia cenocepacia [TaxId:216591] [236250] (5 PDB entries) |
![]() | Domain d4o5ha1: 4o5h A:0-503 [263248] Other proteins in same PDB: d4o5ha2, d4o5hb2 automated match to d4o5hc_ complexed with edo, gol, na |
PDB Entry: 4o5h (more details), 2 Å
SCOPe Domain Sequences for d4o5ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o5ha1 c.82.1.0 (A:0-503) automated matches {Burkholderia cenocepacia [TaxId: 216591]} mvnmetnetfalldatraflakpkqmligaewsdaasgrqldvvnpadgtviarvpeade rdvqqavaaarrafdagpwrtakttdrerlmlvladlieanarelaeiesldngkpvmva qgldvamaaqcfrymagwatkiegsvidagmpylpdseifaytrkepvgvvgaiipwnfp llmaawkiapalatgctvvlkpaedtplsalrlgeliqaagfpdgvvnivtgyghtagaa lsrdpridkiaftgstqtgktighaaldnmtrmslelggkspvivlpdvdldkaaqgvan aiffnqgqvctagsrayihskvfdgviervakiaaslkigpgmdpatqigplvsakqrer vcgyidsgfgegaraaaggraidgpgffveptvlvdttqamrvvreeifgpvlvampfdd vdtavqlandtpyglgasiwsndlsaihklvpriaagtvwvnchslldnalpfggmkqsg fgrelgravidqytesksvmmnya
Timeline for d4o5ha1:
![]() Domains from other chains: (mouse over for more information) d4o5hb1, d4o5hb2, d4o5hc_, d4o5hd_ |