Lineage for d4o0la_ (4o0l A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848369Species Rhodotorula mucilaginosa [TaxId:5537] [258954] (1 PDB entry)
  8. 2848370Domain d4o0la_: 4o0l A: [263239]
    automated match to d4o0lc_
    complexed with ndp

Details for d4o0la_

PDB Entry: 4o0l (more details), 2.2 Å

PDB Description: Crystal structure of NADPH-Dependent 3-Quinuclidinone Reductase from Rhodotorula Rubra
PDB Compounds: (A:) NADPH-dependent 3-quinuclidinone reductase

SCOPe Domain Sequences for d4o0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o0la_ c.2.1.0 (A:) automated matches {Rhodotorula mucilaginosa [TaxId: 5537]}
gpfpkatpqlpnsvfdmfsmkgkvtaitgggggigfaaaeaiaeaggdvallyrsapnme
ersaelakrfgvkvksyqcevtehesvkqaieavekdfgrldcyianagggvpgsinpdy
pleawhktqsvnlhstfyaarecarifkaqgsgsfiattsisarivnvpydqpaynsska
avvhfcrslardwrnfarvntispgffdtpmgpsdkavedvlyqksvlgragdvkelkaa
ylylasnastyttgadllidggyclt

SCOPe Domain Coordinates for d4o0la_:

Click to download the PDB-style file with coordinates for d4o0la_.
(The format of our PDB-style files is described here.)

Timeline for d4o0la_: