| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Rhodotorula mucilaginosa [TaxId:5537] [258954] (1 PDB entry) |
| Domain d4o0la_: 4o0l A: [263239] automated match to d4o0lc_ complexed with ndp |
PDB Entry: 4o0l (more details), 2.2 Å
SCOPe Domain Sequences for d4o0la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o0la_ c.2.1.0 (A:) automated matches {Rhodotorula mucilaginosa [TaxId: 5537]}
gpfpkatpqlpnsvfdmfsmkgkvtaitgggggigfaaaeaiaeaggdvallyrsapnme
ersaelakrfgvkvksyqcevtehesvkqaieavekdfgrldcyianagggvpgsinpdy
pleawhktqsvnlhstfyaarecarifkaqgsgsfiattsisarivnvpydqpaynsska
avvhfcrslardwrnfarvntispgffdtpmgpsdkavedvlyqksvlgragdvkelkaa
ylylasnastyttgadllidggyclt
Timeline for d4o0la_: