Lineage for d1fdpb_ (1fdp B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056436Protein Factor D [50563] (1 species)
  7. 2056437Species Human (Homo sapiens) [TaxId:9606] [50564] (13 PDB entries)
  8. 2056452Domain d1fdpb_: 1fdp B: [26323]
    proenzyme

Details for d1fdpb_

PDB Entry: 1fdp (more details), 2.1 Å

PDB Description: proenzyme of human complement factor d, recombinant profactor d
PDB Compounds: (B:) proenzyme of complement factor d

SCOPe Domain Sequences for d1fdpb_:

Sequence, based on SEQRES records: (download)

>d1fdpb_ b.47.1.2 (B:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
aeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahslsqpeps
krlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcdva
gwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsckgdsggp
lvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

Sequence, based on observed residues (ATOM records): (download)

>d1fdpb_ b.47.1.2 (B:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
aeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahslsqpeps
krlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapgtlcdva
gwgpdslqhvllpvldratcnrrthhdgaiterlmcaesngdsggplvcggvlegvvtsg
kkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d1fdpb_:

Click to download the PDB-style file with coordinates for d1fdpb_.
(The format of our PDB-style files is described here.)

Timeline for d1fdpb_: