| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
| Protein automated matches [227009] (16 species) not a true protein |
| Species Escherichia coli [TaxId:469008] [230194] (6 PDB entries) |
| Domain d4ntnf_: 4ntn F: [263229] automated match to d4ntka_ complexed with fmt, zn |
PDB Entry: 4ntn (more details), 1.99 Å
SCOPe Domain Sequences for d4ntnf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ntnf_ d.96.1.0 (F:) automated matches {Escherichia coli [TaxId: 469008]}
ttlfkdftfeaahrlphvpeghkcgrlhghsfmvrleitgevdphtgwiidfaelkaafk
ptyerldhhylndipglenptsevlakwiwdqvkpvvpllsavmvketctagciyrge
Timeline for d4ntnf_: