![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (25 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries) |
![]() | Domain d4nsta_: 4nst A: [263220] Other proteins in same PDB: d4nstb1, d4nstb2, d4nstd1, d4nstd2 automated match to d4un0c_ protein/RNA complex; complexed with adp, af3, edo, mg |
PDB Entry: 4nst (more details), 2.2 Å
SCOPe Domain Sequences for d4nsta_:
Sequence, based on SEQRES records: (download)
>d4nsta_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} esdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitairei kilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedh iksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnk vitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgsp cpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtl qsdflkdvelskmappdlphwqdchelwskk
>d4nsta_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} esdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitairei kilrqlihrsvvnmkeivtdkqdgafylvfeymdhdlmgllesglvhfsedhiksfmkql megleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvitlwyrp pelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdv iklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdv elskmappdlphwqdchelwskk
Timeline for d4nsta_: