SCOPe 2.05: Domain d4nrnb_: 4nrn B:

Lineage for d4nrnb_ (4nrn B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.0: automated matches [191658] (1 protein)
   not a true family

6. Protein automated matches [191236] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [255534] (2 PDB entries)

8. Domain d4nrnb_: 4nrn B: [263213]
   automated match to d4ltta_
   complexed with zn

Details for d4nrnb_

PDB Entry: 4nrn, 1.8 Å

PDB Description: Crystal structure of metal-bound toxin from Helicobacter pylori

PDB Compounds: (B:) metal-bound toxin

SCOPe Domain Sequences for d4nrnb_:

Sequence; same for both SEQRES and ATOM records:

>d4nrnb_ d.298.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
mltietskkfdkdlkilvkngfdlkllykvvgnlateqplapkykdhplkgglkdfrech
lkpdlllvyqikkqentlflvrlgshself

Timeline for d4nrnb_:

• d4nrnb_ is new in SCOPe 2.05-stable
  
• d4nrnb_ appears in SCOPe 2.06
  
• d4nrnb_ appears in the current release, SCOPe 2.08