Lineage for d4nqzc_ (4nqz C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843356Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [261223] (2 PDB entries)
  8. 2843363Domain d4nqzc_: 4nqz C: [263199]
    automated match to d4nqza_

Details for d4nqzc_

PDB Entry: 4nqz (more details), 2.6 Å

PDB Description: crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in apo form
PDB Compounds: (C:) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI

SCOPe Domain Sequences for d4nqzc_:

Sequence, based on SEQRES records: (download)

>d4nqzc_ c.2.1.2 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
aegtrvnavsagpirtlaasgiksfrkmlaanerqtplrrnvtieevgnagaflcsdlas
gisgeilyvdggfnttam

Sequence, based on observed residues (ATOM records): (download)

>d4nqzc_ c.2.1.2 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
gfltgkralivgvasklsiasgiaaamhregaelaftyqndklrgrveefasgwgsrpel
cfpcdvaddsqieavfaalgkhwdgldiivhsvgfapgdqldgdftavttregfriahdi
saysfialakagremmkgrngslltlsylgaertmpnynvmgmakasleagvrylagslg
aegtrvnavsagpimlaanerqtplrrnvtieevgnagaflcsdlasgisgeilyvdggf
nttam

SCOPe Domain Coordinates for d4nqzc_:

Click to download the PDB-style file with coordinates for d4nqzc_.
(The format of our PDB-style files is described here.)

Timeline for d4nqzc_: