Lineage for d4nqgb_ (4nqg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711331Species Mitrocoma cellularia [TaxId:31874] [261220] (1 PDB entry)
  8. 2711333Domain d4nqgb_: 4nqg B: [263197]
    automated match to d4nqga_
    complexed with czh

Details for d4nqgb_

PDB Entry: 4nqg (more details), 1.3 Å

PDB Description: Crystal Structure of Ca(2+)-regulated photoprotein mitrocomin from Jellyfish Mitrocoma cellularia at 1.3 Angstrom resolution
PDB Compounds: (B:) Mitrocomin

SCOPe Domain Sequences for d4nqgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqgb_ a.39.1.5 (B:) automated matches {Mitrocoma cellularia [TaxId: 31874]}
smgsryavkldtdfdnpkwiarhkhmfnfldinsngqinlnemvhkasniickklgatee
qtrrhqkcvedffggagleydkdttwpeyiegwkrlaktelerhsknrvtlirlwgdalf
diidkdgngsvsldewiqythcagiqqsrgqceatfahcdldgdgkldvdemtrqhlgfw
ysvdstceglyggavpy

SCOPe Domain Coordinates for d4nqgb_:

Click to download the PDB-style file with coordinates for d4nqgb_.
(The format of our PDB-style files is described here.)

Timeline for d4nqgb_: