![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4nqdg2: 4nqd G:111-199 [263194] Other proteins in same PDB: d4nqda1, d4nqda2, d4nqdb_, d4nqdc1, d4nqdc2, d4nqdd1, d4nqde1, d4nqde2, d4nqdf_, d4nqdg1, d4nqdh1, d4nqdh2 automated match to d2f54d2 complexed with 2lj, gol |
PDB Entry: 4nqd (more details), 2.2 Å
SCOPe Domain Sequences for d4nqdg2:
Sequence, based on SEQRES records: (download)
>d4nqdg2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d4nqdg2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdsvclftdfdsqtnvsqsdvyitdkcvldmrsmdfksnsavawsnksd facanafnnsiipedtffps
Timeline for d4nqdg2: