Lineage for d4nqdg2 (4nqd G:111-199)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750512Domain d4nqdg2: 4nqd G:111-199 [263194]
    Other proteins in same PDB: d4nqda1, d4nqda2, d4nqdb_, d4nqdc1, d4nqdc2, d4nqdd1, d4nqde1, d4nqde2, d4nqdf_, d4nqdg1, d4nqdh1, d4nqdh2
    automated match to d2f54d2
    complexed with 2lj, gol

Details for d4nqdg2

PDB Entry: 4nqd (more details), 2.2 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil
PDB Compounds: (G:) TcR alpha chain

SCOPe Domain Sequences for d4nqdg2:

Sequence, based on SEQRES records: (download)

>d4nqdg2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4nqdg2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqsdvyitdkcvldmrsmdfksnsavawsnksd
facanafnnsiipedtffps

SCOPe Domain Coordinates for d4nqdg2:

Click to download the PDB-style file with coordinates for d4nqdg2.
(The format of our PDB-style files is described here.)

Timeline for d4nqdg2: