Lineage for d4nqdg1 (4nqd G:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755700Domain d4nqdg1: 4nqd G:1-110 [263193]
    Other proteins in same PDB: d4nqda1, d4nqdb_, d4nqdc1, d4nqdc2, d4nqdf_, d4nqdg2
    automated match to d2f54d1
    complexed with 2lj, gol

Details for d4nqdg1

PDB Entry: 4nqd (more details), 2.2 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil
PDB Compounds: (G:) TcR alpha chain

SCOPe Domain Sequences for d4nqdg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqdg1 b.1.1.0 (G:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d4nqdg1:

Click to download the PDB-style file with coordinates for d4nqdg1.
(The format of our PDB-style files is described here.)

Timeline for d4nqdg1: