Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
Domain d4nqda2: 4nqd A:179-269 [263189] Other proteins in same PDB: d4nqda1, d4nqdb_, d4nqdc1, d4nqdc2, d4nqdf_, d4nqdg2 automated match to d4l4va2 complexed with 2lj, gol |
PDB Entry: 4nqd (more details), 2.2 Å
SCOPe Domain Sequences for d4nqda2:
Sequence, based on SEQRES records: (download)
>d4nqda2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty qawasieldpqssnlyschvehsgvhmvlqv
>d4nqda2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]} tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeieidygdilpsgdgtyqa wasielyschvehsgvhmvlqv
Timeline for d4nqda2: