| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4nqch2: 4nqc H:117-243 [263187] Other proteins in same PDB: d4nqca1, d4nqca3, d4nqcb_, d4nqcc1, d4nqcc3, d4nqcd2, d4nqcf_, d4nqcg2 automated match to d2vlme2 complexed with 2lj, na |
PDB Entry: 4nqc (more details), 2.5 Å
SCOPe Domain Sequences for d4nqch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nqch2 b.1.1.0 (H:117-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr
Timeline for d4nqch2: