Lineage for d4nqcg1 (4nqc G:2-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756315Domain d4nqcg1: 4nqc G:2-110 [263184]
    Other proteins in same PDB: d4nqca1, d4nqca3, d4nqcb_, d4nqcc1, d4nqcc3, d4nqcd2, d4nqcf_, d4nqcg2
    automated match to d2f54d1
    complexed with 2lj, na

Details for d4nqcg1

PDB Entry: 4nqc (more details), 2.5 Å

PDB Description: Crystal structure of TCR-MR1 ternary complex and covalently bound 5-(2-oxopropylideneamino)-6-D-ribitylaminouracil
PDB Compounds: (G:) TcR alpha chain

SCOPe Domain Sequences for d4nqcg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqcg1 b.1.1.0 (G:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d4nqcg1:

Click to download the PDB-style file with coordinates for d4nqcg1.
(The format of our PDB-style files is described here.)

Timeline for d4nqcg1: