SCOPe 2.06: Domain d4no4e_: 4no4 E:

Lineage for d4no4e_ (4no4 E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries)

8. Domain d4no4e_: 4no4 E: [263175]
   automated match to d4no4b_
   complexed with gol, lat, mg, so4; mutant

Details for d4no4e_

PDB Entry: 4no4, 1.4 Å

PDB Description: crystal structure of galectin-1 l11a mutant

PDB Compounds: (E:) galectin-1

SCOPe Domain Sequences for d4no4e_:

Sequence; same for both SEQRES and ATOM records:

>d4no4e_ b.29.1.3 (E:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
acglvasnlnakpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkikcvafe

Timeline for d4no4e_:

• d4no4e_ first appeared in SCOPe 2.05
  
• d4no4e_ appears in SCOPe 2.07
  
• d4no4e_ appears in the current release, SCOPe 2.08