Lineage for d4no4c_ (4no4 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388863Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2388881Protein Galectin-1 [100925] (5 species)
  7. 2388969Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries)
  8. 2388972Domain d4no4c_: 4no4 C: [263173]
    automated match to d4no4b_
    complexed with gol, lat, mg, so4; mutant

Details for d4no4c_

PDB Entry: 4no4 (more details), 1.4 Å

PDB Description: crystal structure of galectin-1 l11a mutant
PDB Compounds: (C:) galectin-1

SCOPe Domain Sequences for d4no4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4no4c_ b.29.1.3 (C:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
acglvasnlnakpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkikcvafe

SCOPe Domain Coordinates for d4no4c_:

Click to download the PDB-style file with coordinates for d4no4c_.
(The format of our PDB-style files is described here.)

Timeline for d4no4c_: