| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein Galectin-1 [100925] (5 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries) |
| Domain d4no4c_: 4no4 C: [263173] automated match to d4no4b_ complexed with gol, mg, so4; mutant |
PDB Entry: 4no4 (more details), 1.4 Å
SCOPe Domain Sequences for d4no4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4no4c_ b.29.1.3 (C:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
acglvasnlnakpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkikcvafe
Timeline for d4no4c_: