Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (9 PDB entries) |
Domain d4nnje1: 4nnj E:1-76 [263171] Other proteins in same PDB: d4nnjb2, d4nnjd2, d4nnje2 automated match to d3dbhi_ complexed with amp, gol, so4 |
PDB Entry: 4nnj (more details), 2.4 Å
SCOPe Domain Sequences for d4nnje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nnje1 d.15.1.0 (E:1-76) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d4nnje1:
View in 3D Domains from other chains: (mouse over for more information) d4nnjb1, d4nnjb2, d4nnjd1, d4nnjd2 |