SCOPe 2.08: Domain d4nnje1: 4nnj E:1-76

Lineage for d4nnje1 (4nnj E:1-76)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (9 PDB entries)

8. Domain d4nnje1: 4nnj E:1-76 [263171]
   Other proteins in same PDB: d4nnjb2, d4nnjd2, d4nnje2
   automated match to d3dbhi_
   complexed with amp, gol, so4

Details for d4nnje1

PDB Entry: 4nnj, 2.4 Å

PDB Description: Crystal structure of Uba1 in complex with ubiquitin-AMP and thioesterified ubiquitin

PDB Compounds: (E:) Uba1

SCOPe Domain Sequences for d4nnje1:

Sequence; same for both SEQRES and ATOM records:

>d4nnje1 d.15.1.0 (E:1-76) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

Timeline for d4nnje1:

• d4nnje1 first appeared in SCOPe 2.05, called d4nnje_
  
• d4nnje1 appears in SCOPe 2.07