Lineage for d4nmjd_ (4nmj D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141521Species Pyrobaculum sp. [TaxId:1104324] [228031] (9 PDB entries)
  8. 2141533Domain d4nmjd_: 4nmj D: [263165]
    automated match to d4nmja_
    complexed with nap

Details for d4nmjd_

PDB Entry: 4nmj (more details), 2 Å

PDB Description: Thermostable aldehyde dehydrogenase from Pyrobaculum sp. complexed with NADP+ at 2 A resolution
PDB Compounds: (D:) aldehyde dehydrogenase

SCOPe Domain Sequences for d4nmjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nmjd_ c.82.1.0 (D:) automated matches {Pyrobaculum sp. [TaxId: 1104324]}
vanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanipai
rraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqgrv
lqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvtgw
liaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagtlk
tvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfieryv
hyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffepai
fvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafriaea
vesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpips
alk

SCOPe Domain Coordinates for d4nmjd_:

Click to download the PDB-style file with coordinates for d4nmjd_.
(The format of our PDB-style files is described here.)

Timeline for d4nmjd_: