Lineage for d4nkrc1 (4nkr C:11-172)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128302Species Bacillus subtilis [TaxId:655816] [261215] (2 PDB entries)
  8. 2128305Domain d4nkrc1: 4nkr C:11-172 [263152]
    Other proteins in same PDB: d4nkra2, d4nkrb2, d4nkrc2, d4nkrd2, d4nkre2
    automated match to d4nkra_
    complexed with so4

Details for d4nkrc1

PDB Entry: 4nkr (more details), 2.41 Å

PDB Description: the crystal structure of bacillus subtilis mobb
PDB Compounds: (C:) Molybdopterin-guanine dinucleotide biosynthesis protein B

SCOPe Domain Sequences for d4nkrc1:

Sequence, based on SEQRES records: (download)

>d4nkrc1 c.37.1.0 (C:11-172) automated matches {Bacillus subtilis [TaxId: 655816]}
pivqvvgfqnsgkttfierilekaseqglnlgclkhhghggepqtftegkdtdryqaaga
dvtavegagvlqltarrlwdltrlielyqfletdclliegfkkapypkvvilsekedlea
lktvntiaiiyrkkehmtehqglpifhaddpvavdlvlsqlk

Sequence, based on observed residues (ATOM records): (download)

>d4nkrc1 c.37.1.0 (C:11-172) automated matches {Bacillus subtilis [TaxId: 655816]}
pivqvvgfqnsgkttfierilekaseqglnlgclkhhdryqaagadvtavegagvlqlta
rrlwdltrlielyqfletdclliegfkkapypkvvilsekedlealktvntiaiiyrkke
hmtehqglpifhaddpvavdlvlsqlk

SCOPe Domain Coordinates for d4nkrc1:

Click to download the PDB-style file with coordinates for d4nkrc1.
(The format of our PDB-style files is described here.)

Timeline for d4nkrc1: