| Class b: All beta proteins [48724] (180 folds) |
| Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
| Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
| Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
| Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries) |
| Domain d4njtd_: 4njt D: [263150] automated match to d4njta_ complexed with 017 |
PDB Entry: 4njt (more details), 1.95 Å
SCOPe Domain Sequences for d4njtd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4njtd_ b.50.1.1 (D:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgftlnf
Timeline for d4njtd_: