SCOPe 2.06: Domain d4njtc_: 4njt C:

Lineage for d4njtc_ (4njt C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (50 PDB entries)

8. Domain d4njtc_: 4njt C: [263149]
   automated match to d4njta_
   complexed with 017

Details for d4njtc_

PDB Entry: 4njt, 1.95 Å

PDB Description: Crystal structure of multidrug-resistant clinical isolate A02 HIV-1 protease in complex with darunavir

PDB Compounds: (C:) Protease

SCOPe Domain Sequences for d4njtc_:

Sequence; same for both SEQRES and ATOM records:

>d4njtc_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgftlnf

Timeline for d4njtc_:

• d4njtc_ first appeared in SCOPe 2.05
  
• d4njtc_ appears in SCOPe 2.07
  
• d4njtc_ appears in the current release, SCOPe 2.08