SCOPe 2.06: Domain d4njsb_: 4njs B:

Lineage for d4njsb_ (4njs B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)

8. Domain d4njsb_: 4njs B: [263147]
   automated match to d4njsa_
   complexed with g08

Details for d4njsb_

PDB Entry: 4njs, 1.8 Å

PDB Description: Crystal structure of multidrug-resistant clinical isolate A02 HIV-1 protease in complex with non-peptidic inhibitor, GRL008

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d4njsb_:

Sequence; same for both SEQRES and ATOM records:

>d4njsb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrwkprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

Timeline for d4njsb_:

• d4njsb_ first appeared in SCOPe 2.05
  
• d4njsb_ appears in SCOPe 2.07
  
• d4njsb_ appears in the current release, SCOPe 2.08