SCOPe 2.07: Domain d1bioa_: 1bio A:

Lineage for d1bioa_ (1bio A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Factor D [50563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50564] (24 PDB entries)

8. Domain d1bioa_: 1bio A: [26314]
   complexed with gol, soa

Details for d1bioa_

PDB Entry: 1bio, 1.5 Å

PDB Description: human complement factor d in complex with isatoic anhydride inhibitor

PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d1bioa_:

Sequence; same for both SEQRES and ATOM records:

>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

Timeline for d1bioa_:

• d1bioa_ first appeared (with stable ids) in SCOP 1.55, called d1bio__
  
• d1bioa_ appears in SCOPe 2.06
  
• d1bioa_ appears in the current release, SCOPe 2.08