Lineage for d4ndnb3 (4ndn B:252-395)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976515Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. 2976623Domain d4ndnb3: 4ndn B:252-395 [263125]
    Other proteins in same PDB: d4ndne_, d4ndnf_
    automated match to d2obva3
    complexed with edo, mg, ppk, sam

Details for d4ndnb3

PDB Entry: 4ndn (more details), 2.34 Å

PDB Description: structural insights of mat enzymes: mata2b complexed with sam and ppnp
PDB Compounds: (B:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d4ndnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ndnb3 d.130.1.0 (B:252-395) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglc
rrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiy
qrtaayghfgrdsfpwevpkklky

SCOPe Domain Coordinates for d4ndnb3:

Click to download the PDB-style file with coordinates for d4ndnb3.
(The format of our PDB-style files is described here.)

Timeline for d4ndnb3: