SCOPe 2.06: Domain d4ndda_: 4ndd A:

Lineage for d4ndda_ (4ndd A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Doryteuthis pealeii [TaxId:1051067] [260698] (4 PDB entries)

8. Domain d4ndda_: 4ndd A: [263122]
   automated match to d2ccma_
   complexed with ca; mutant

Details for d4ndda_

PDB Entry: 4ndd, 2.9 Å

PDB Description: x-ray structure of a double mutant of calexcitin - a neuronal calcium- signalling protein

PDB Compounds: (A:) calexcitin

SCOPe Domain Sequences for d4ndda_:

Sequence; same for both SEQRES and ATOM records:

>d4ndda_ a.39.1.0 (A:) automated matches {Doryteuthis pealeii [TaxId: 1051067]}
qlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearadlkl
iwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndtsgdn
iidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgakgnh
lfgdlkl

Timeline for d4ndda_:

• d4ndda_ first appeared in SCOPe 2.05
  
• d4ndda_ appears in SCOPe 2.07
  
• d4ndda_ appears in the current release, SCOPe 2.08