Lineage for d4nd1a2 (4nd1 A:165-333)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998790Species Cryptosporidium parvum [TaxId:5807] [225186] (10 PDB entries)
  8. 2998807Domain d4nd1a2: 4nd1 A:165-333 [263119]
    Other proteins in same PDB: d4nd1a1, d4nd1b1
    complexed with gol, nad, oxm

Details for d4nd1a2

PDB Entry: 4nd1 (more details), 2.15 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with cofactor (b-nicotinamide adenine dinucleotide) and inhibitor (oxamic acid)
PDB Compounds: (A:) Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase

SCOPe Domain Sequences for d4nd1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nd1a2 d.162.1.1 (A:165-333) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntiskvldnap

SCOPe Domain Coordinates for d4nd1a2:

Click to download the PDB-style file with coordinates for d4nd1a2.
(The format of our PDB-style files is described here.)

Timeline for d4nd1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nd1a1