Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) oligomerizes into a pentameric ring structure |
Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins) automatically mapped to Pfam PF03066 |
Protein automated matches [190762] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [237668] (1 PDB entry) |
Domain d4n8md_: 4n8m D: [263110] automated match to d4n8mb_ complexed with co |
PDB Entry: 4n8m (more details), 1.8 Å
SCOPe Domain Sequences for d4n8md_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n8md_ b.121.3.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pqnylfgcelkadkdyhfkvdndenehqlslrtvslgagakdelhiveaeamnyegspik vtlatlkmsvqptvslggfeitppvvlrlkcgsgpvhisgqhlva
Timeline for d4n8md_:
View in 3D Domains from other chains: (mouse over for more information) d4n8ma_, d4n8mb_, d4n8mc_, d4n8me_ |