Lineage for d1sgfz_ (1sgf Z:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670412Protein 7S NGF protease subunits [50559] (1 species)
    two pairs of homologous but non-identical chains
  7. 670413Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry)
  8. 670417Domain d1sgfz_: 1sgf Z: [26311]
    Other proteins in same PDB: d1sgfb_, d1sgfy_
    complexed with nag, zn

Details for d1sgfz_

PDB Entry: 1sgf (more details), 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
PDB Compounds: (Z:) nerve growth factor

SCOP Domain Sequences for d1sgfz_:

Sequence, based on SEQRES records: (download)

>d1sgfz_ b.47.1.2 (Z:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
psaqhrfvskaiphpgfnmslmrkhirfleydysndlmllrlskpaditdtvkpitlpte
epklgstclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdg
gkdtckgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp

Sequence, based on observed residues (ATOM records): (download)

>d1sgfz_ b.47.1.2 (Z:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
psaqhrfvskaiphpgfnmslmfleydysndlmllrlskpaditdtvkpitlpteepklg
stclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdggkdtc
kgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp

SCOP Domain Coordinates for d1sgfz_:

Click to download the PDB-style file with coordinates for d1sgfz_.
(The format of our PDB-style files is described here.)

Timeline for d1sgfz_: