Lineage for d4n5gc_ (4n5g C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729438Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2729439Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
    Uniprot P19793 227-458
  8. 2729461Domain d4n5gc_: 4n5g C: [263105]
    automated match to d1lbda_
    complexed with k09

Details for d4n5gc_

PDB Entry: 4n5g (more details), 2.11 Å

PDB Description: Crystal Structure of RXRa LBD complexed with a synthetic modulator K8012
PDB Compounds: (C:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d4n5gc_:

Sequence, based on SEQRES records: (download)

>d4n5gc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriphfs
elplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvl
telvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkype
qpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d4n5gc_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
pverileaelapndpvtnicqaadkqlftlvewakriphfselplddqvillragwnell
iasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgc
lraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsig
lkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d4n5gc_:

Click to download the PDB-style file with coordinates for d4n5gc_.
(The format of our PDB-style files is described here.)

Timeline for d4n5gc_: