Lineage for d1sgfx_ (1sgf X:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465274Protein 7S NGF protease subunits [50559] (1 species)
    two pairs of homologous but non-identical chains
  7. 465275Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry)
  8. 465278Domain d1sgfx_: 1sgf X: [26310]
    Other proteins in same PDB: d1sgfb_, d1sgfy_

Details for d1sgfx_

PDB Entry: 1sgf (more details), 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)

SCOP Domain Sequences for d1sgfx_:

Sequence, based on SEQRES records: (download)

>d1sgfx_ b.47.1.2 (X:) 7S NGF protease subunits {Mouse (Mus musculus)}
sqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgknnfledepsdqhrlvsk
aiphpdfnmsllnehtpqpeddysndlmllrlskpaditdvvkpitlpteepklgstcla
sgwgsttpikypddlqcvnlkllpnedcdkahemkvtdamlcagemdggsytcehdsggp
licdgilqgitswgpepcgeptepsvytklikfsswiretman

Sequence, based on observed residues (ATOM records): (download)

>d1sgfx_ b.47.1.2 (X:) 7S NGF protease subunits {Mouse (Mus musculus)}
sqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgkddqhrlvskaiphpdfn
msllnehtpqpeddysndlmllrlskpaditdvvkpitlpteepklgstclasgtcvnlk
llpnedcdkahemkvtdamlcagemdggsytcehdsggplicdgilqgitswgpepcgep
tepsvytklikfsswiretman

SCOP Domain Coordinates for d1sgfx_:

Click to download the PDB-style file with coordinates for d1sgfx_.
(The format of our PDB-style files is described here.)

Timeline for d1sgfx_: