Lineage for d1sgfg_ (1sgf G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793426Protein 7S NGF protease subunits [50559] (1 species)
    two pairs of homologous but non-identical chains
  7. 1793427Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry)
  8. 1793429Domain d1sgfg_: 1sgf G: [26309]
    Other proteins in same PDB: d1sgfb_, d1sgfy_
    complexed with nag, zn

Details for d1sgfg_

PDB Entry: 1sgf (more details), 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
PDB Compounds: (G:) nerve growth factor

SCOPe Domain Sequences for d1sgfg_:

Sequence, based on SEQRES records: (download)

>d1sgfg_ b.47.1.2 (G:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
psaqhrfvskaiphpgfnmslmrkhirfleydysndlmllrlskpaditdtvkpitlpte
epklgstclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdg
gkdtckgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp

Sequence, based on observed residues (ATOM records): (download)

>d1sgfg_ b.47.1.2 (G:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
ivggfkceknsqpwhvavyrytqylcggvlldpnwvltaahcyddnykvwlgknnlfkde
psaqhrfvskaiphpgfnmslmfleydysndlmllrlskpaditdtvkpitlpteepklg
stclasgwgsitptkfqftddlycvnlkllpnedcakahiekvtdamlcagemdggkdtc
kgdsggplicdgvlqgitswghtpcgepdmpgvytklnkftswikdtmaknp

SCOPe Domain Coordinates for d1sgfg_:

Click to download the PDB-style file with coordinates for d1sgfg_.
(The format of our PDB-style files is described here.)

Timeline for d1sgfg_: