Lineage for d4mzoh_ (4mzo H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926957Protein automated matches [190264] (12 species)
    not a true protein
  7. 2927006Species Mouse (Mus musculus) [TaxId:10090] [229208] (7 PDB entries)
  8. 2927017Domain d4mzoh_: 4mzo H: [263086]
    automated match to d4bs5a_
    complexed with 2ew

Details for d4mzoh_

PDB Entry: 4mzo (more details), 1.47 Å

PDB Description: mouse cathepsin s with covalent ligand (3s,4s)-n-[(2e)-2-iminoethyl]- 4-(morpholin-4-ylcarbonyl)-1-(phenylsulfonyl)pyrrolidine-3- carboxamide
PDB Compounds: (H:) cathepsin S

SCOPe Domain Sequences for d4mzoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mzoh_ d.3.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lpdtvdwrekgcvtevkyqgscgacwafsavgalegqlklktgklislsaqnlvdcsnee
kygnkgcgggymteafqyiidnggieadasypykamdekchynsknraatcsryiqlpfg
dedalkeavatkgpvsvgidashssfffyksgvyddpsctgnvnhgvlvvgygtldgkdy
wlvknswglnfgdqgyirmarnnknhcgiasycsypei

SCOPe Domain Coordinates for d4mzoh_:

Click to download the PDB-style file with coordinates for d4mzoh_.
(The format of our PDB-style files is described here.)

Timeline for d4mzoh_: