Lineage for d1sgfa_ (1sgf A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802321Protein 7S NGF protease subunits [50559] (1 species)
    two pairs of homologous but non-identical chains
  7. 802322Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry)
  8. 802323Domain d1sgfa_: 1sgf A: [26308]
    Other proteins in same PDB: d1sgfb_, d1sgfy_

Details for d1sgfa_

PDB Entry: 1sgf (more details), 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
PDB Compounds: (A:) nerve growth factor

SCOP Domain Sequences for d1sgfa_:

Sequence, based on SEQRES records: (download)

>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
nsqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgknnfledepsdqhrlvs
kaiphpdfnmsllnehtpqpeddysndlmllrlskpaditdvvkpitlpteepklgstcl
asgwgsttpikfkypddlqcvnlkllpnedcdkahemkvtdamlcagemdggsytcehds
ggplicdgilqgitswgpepcgeptepsvytklikfsswiretmannp

Sequence, based on observed residues (ATOM records): (download)

>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
nsqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgkeepsdqhrlvskaiph
pdfnmsllpqpeddysndlmllrlskpaditdvvkpitlpteepklgstclasicvnlkl
lpnedcdkahemkvtdamlcagemdggsytcehdsggplicdgilqgitswgpepcgept
epsvytklikfsswiretmannp

SCOP Domain Coordinates for d1sgfa_:

Click to download the PDB-style file with coordinates for d1sgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1sgfa_: