SCOP 1.73: Domain d1sgfa_: 1sgf A:

Lineage for d1sgfa_ (1sgf A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein 7S NGF protease subunits [50559] (1 species)
   two pairs of homologous but non-identical chains

7. Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry)

8. Domain d1sgfa_: 1sgf A: [26308]
   Other proteins in same PDB: d1sgfb_, d1sgfy_

Details for d1sgfa_

PDB Entry: 1sgf, 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)

PDB Compounds: (A:) nerve growth factor

SCOP Domain Sequences for d1sgfa_:

Sequence, based on SEQRES records:

>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
nsqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgknnfledepsdqhrlvs
kaiphpdfnmsllnehtpqpeddysndlmllrlskpaditdvvkpitlpteepklgstcl
asgwgsttpikfkypddlqcvnlkllpnedcdkahemkvtdamlcagemdggsytcehds
ggplicdgilqgitswgpepcgeptepsvytklikfsswiretmannp

Sequence, based on observed residues (ATOM records):

>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}
nsqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgkeepsdqhrlvskaiph
pdfnmsllpqpeddysndlmllrlskpaditdvvkpitlpteepklgstclasicvnlkl
lpnedcdkahemkvtdamlcagemdggsytcehdsggplicdgilqgitswgpepcgept
epsvytklikfsswiretmannp

Timeline for d1sgfa_:

• d1sgfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1sgfa_ appears in SCOP 1.71
  
• d1sgfa_ appears in SCOP 1.75
  
• d1sgfa_ appears in the current release, SCOPe 2.08