Lineage for d1sgfa_ (1sgf A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 111731Protein 7S NGF protease subunits [50559] (1 species)
  7. 111732Species Mouse (Mus musculus) [TaxId:10090] [50560] (1 PDB entry)
  8. 111733Domain d1sgfa_: 1sgf A: [26308]
    Other proteins in same PDB: d1sgfb_, d1sgfy_

Details for d1sgfa_

PDB Entry: 1sgf (more details), 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)

SCOP Domain Sequences for d1sgfa_:

Sequence, based on SEQRES records: (download)

>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus)}
nsqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgknnfledepsdqhrlvs
kaiphpdfnmsllnehtpqpeddysndlmllrlskpaditdvvkpitlpteepklgstcl
asgwgsttpikypddlqcvnlkllpnedcdkahemkvtdamlcagemdggsytcehdsgg
plicdgilqgitswgpepcgeptepsvytklikfsswiretmannp

Sequence, based on observed residues (ATOM records): (download)

>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus)}
nsqpwhvavyrfnkyqcggvlldrnwvltaahcyndkyqvwlgkeepsdqhrlvskaiph
pdfnmsllpqpeddysndlmllrlskpaditdvvkpitlpteepklgstclasicvnlkl
lpnedcdkahemkvtdamlcagemdggsytcehdsggplicdgilqgitswgpepcgept
epsvytklikfsswiretmannp

SCOP Domain Coordinates for d1sgfa_:

Click to download the PDB-style file with coordinates for d1sgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1sgfa_: