Lineage for d4my5b_ (4my5 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132921Species Streptococcus mutans [TaxId:210007] [255923] (2 PDB entries)
  8. 2132925Domain d4my5b_: 4my5 B: [263064]
    automated match to d4my5a_
    mutant

Details for d4my5b_

PDB Entry: 4my5 (more details), 2.19 Å

PDB Description: Crystal structure of the aromatic amino acid aminotransferase from Streptococcus mutants
PDB Compounds: (B:) Putative amino acid aminotransferase

SCOPe Domain Sequences for d4my5b_:

Sequence, based on SEQRES records: (download)

>d4my5b_ c.67.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
mdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraidade
shytgmagllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkvll
papaypgyepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnptg
vtysrqqiknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglsksha
mtgwrlglifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyikrr
dyiiekmeamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgkyg
egylrisyaasmetikeamkrlkefmeqy

Sequence, based on observed residues (ATOM records): (download)

>d4my5b_ c.67.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
mdlskrfnknlnkievsmirqfdqsisdipdvlkltlgepdfatpkhikeaakraidada
gllalrqaasafvkekyhltynpdneilvtigatealsasltailepgdkvllpapaypg
yepvvnlvgaevveidtrsndfvltpemleeailkegealkavilnyptnptgvtysrqq
iknlaevlkkypifvisdevyaeltytgeshvsiaeylpdqtilisglskshamtgwrlg
lifapavltaqlikshqylvtaattsvqfaaiealtngkddalpmkeeyikrrdyiiekm
eamkfkiikpdgafyifakipvaqgqdsfkflqdfakekavafipgvafgkygegylris
yaasmetikeamkrlkefmeqy

SCOPe Domain Coordinates for d4my5b_:

Click to download the PDB-style file with coordinates for d4my5b_.
(The format of our PDB-style files is described here.)

Timeline for d4my5b_: