Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Kallikrein A [50555] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries) |
Domain d2kai.1: 2kai A:,B: [26306] Other proteins in same PDB: d2kaii_ |
PDB Entry: 2kai (more details), 2.5 Å
SCOPe Domain Sequences for d2kai.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g2kai.1 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene ntaqffgvtadfphpgfnlsXadgkdyshdlmllrlqspakitdavkvlelptqepelgs tceasgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdt cmgdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp
Timeline for d2kai.1: