Lineage for d2kai.1 (2kai A:,B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065129Protein Kallikrein A [50555] (1 species)
  7. 2065130Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries)
  8. 2065135Domain d2kai.1: 2kai A:,B: [26306]
    Other proteins in same PDB: d2kaii_

Details for d2kai.1

PDB Entry: 2kai (more details), 2.5 Å

PDB Description: refined 2.5 angstroms x-ray crystal structure of the complex formed by porcine kallikrein a and the bovine pancreatic trypsin inhibitor. crystallization, patterson search, structure determination, refinement, structure and comparison with its components and with the bovine trypsin-pancreatic trypsin inhibitor complex
PDB Compounds: (A:) kallikrein a, (B:) kallikrein a

SCOPe Domain Sequences for d2kai.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2kai.1 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]}
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnlsXadgkdyshdlmllrlqspakitdavkvlelptqepelgs
tceasgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdt
cmgdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp

SCOPe Domain Coordinates for d2kai.1:

Click to download the PDB-style file with coordinates for d2kai.1.
(The format of our PDB-style files is described here.)

Timeline for d2kai.1: