SCOPe 2.05: Domain d4mrwb_: 4mrw B:

Lineage for d4mrwb_ (4mrw B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d4mrwb_: 4mrw B: [263054]
   automated match to d4lm1a_
   complexed with mrw, ni

Details for d4mrwb_

PDB Entry: 4mrw, 1.96 Å

PDB Description: crystal structure of pde10a2 with fragment zt0120 (7-chloroquinolin-4- ol)

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4mrwb_:

Sequence; same for both SEQRES and ATOM records:

>d4mrwb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir
kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl
tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp
tepllkacrdnlsqwekvirgeet

Timeline for d4mrwb_:

• d4mrwb_ is new in SCOPe 2.05-stable
  
• d4mrwb_ is called d4mrwb1 in SCOPe 2.06
  
• d4mrwb_ appears in the current release, SCOPe 2.08, called d4mrwb1