Lineage for d4mrtc_ (4mrt C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731062Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1731161Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 1731162Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 1731163Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)
  8. 1731164Domain d4mrtc_: 4mrt C: [263053]
    Other proteins in same PDB: d4mrta1, d4mrta2
    automated match to d2md9a_
    complexed with coa, gol, mg, so4

Details for d4mrtc_

PDB Entry: 4mrt (more details), 2 Å

PDB Description: Structure of the Phosphopantetheine Transferase Sfp in Complex with Coenzyme A and a Peptidyl Carrier Protein
PDB Compounds: (C:) Tyrocidine synthase 3

SCOPe Domain Sequences for d4mrtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mrtc_ a.28.1.2 (C:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
yvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqvelplkv
lfaqptikalaqyvatr

SCOPe Domain Coordinates for d4mrtc_:

Click to download the PDB-style file with coordinates for d4mrtc_.
(The format of our PDB-style files is described here.)

Timeline for d4mrtc_: