![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein) |
![]() | Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species) |
![]() | Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries) |
![]() | Domain d4mrtc1: 4mrt C:8-83 [263053] Other proteins in same PDB: d4mrta1, d4mrta2, d4mrta3, d4mrtc2 automated match to d2md9a_ complexed with coa, gol, mg, so4 |
PDB Entry: 4mrt (more details), 2 Å
SCOPe Domain Sequences for d4mrtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mrtc1 a.28.1.2 (C:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} yvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqvelplkv lfaqptikalaqyvat
Timeline for d4mrtc1: