SCOPe 2.08: Domain d4mrtc1: 4mrt C:8-83

Lineage for d4mrtc1 (4mrt C:8-83)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)

6. Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)

7. Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)

8. Domain d4mrtc1: 4mrt C:8-83 [263053]
   Other proteins in same PDB: d4mrta1, d4mrta2, d4mrta3, d4mrtc2
   automated match to d2md9a_
   complexed with coa, gol, mg, so4

Details for d4mrtc1

PDB Entry: 4mrt, 2 Å

PDB Description: Structure of the Phosphopantetheine Transferase Sfp in Complex with Coenzyme A and a Peptidyl Carrier Protein

PDB Compounds: (C:) Tyrocidine synthase 3

SCOPe Domain Sequences for d4mrtc1:

Sequence; same for both SEQRES and ATOM records:

>d4mrtc1 a.28.1.2 (C:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
yvaptnavesklaeiwervlgvsgigildnffqigghalkamavaaqvhreyqvelplkv
lfaqptikalaqyvat

Timeline for d4mrtc1:

• d4mrtc1 first appeared in SCOPe 2.05, called d4mrtc_
  
• d4mrtc1 appears in SCOPe 2.07