Lineage for d4mm0b_ (4mm0 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005908Species Streptomyces griseoviridis [TaxId:45398] [259670] (1 PDB entry)
  8. 2005910Domain d4mm0b_: 4mm0 B: [263038]
    automated match to d2y5nb_
    complexed with hem

Details for d4mm0b_

PDB Entry: 4mm0 (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of the Putative Thioether Synthase SgvP Involved in the Tailoring Step of Griseoviridin
PDB Compounds: (B:) P450-like monooxygenase

SCOPe Domain Sequences for d4mm0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mm0b_ a.104.1.0 (B:) automated matches {Streptomyces griseoviridis [TaxId: 45398]}
asatrhpypfdravptaipplyeelretervaaitmatgdpgflvtryedvrfvlsdprf
svrqdlpgaprltemtfesvmttdppvhtrlrrllsrdftarriermrprleeiaeglld
emekkgapadiveslavpfpitvicellgvpmvdvarfrgwadtmvsltgysmedwtaar
dalesyldglvaakrenpgsdllsalvataaedneltdhdvrslslilllagyepasnql
gssvltllrfpdrlaelrrdpgllpsaveelmryapagdgalfrvtledvtigdthipan
savlastqaanwdprrfddptglrldrpdnqhtalghgihfclgaalarvelqvaigall
rrfprlalatdesglrwsspgsmlsgfaeipvtw

SCOPe Domain Coordinates for d4mm0b_:

Click to download the PDB-style file with coordinates for d4mm0b_.
(The format of our PDB-style files is described here.)

Timeline for d4mm0b_: