Lineage for d4ml0l_ (4ml0 L:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947487Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 1947488Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 1947520Family d.298.1.0: automated matches [191658] (1 protein)
    not a true family
  6. 1947521Protein automated matches [191236] (5 species)
    not a true protein
  7. 1947527Species Escherichia coli [TaxId:83333] [257085] (4 PDB entries)
  8. 1947542Domain d4ml0l_: 4ml0 L: [263035]
    automated match to d4mmga_
    complexed with so4

Details for d4ml0l_

PDB Entry: 4ml0 (more details), 2.1 Å

PDB Description: Crystal structure of E.coli DinJ-YafQ complex
PDB Compounds: (L:) Predicted toxin of the YafQ-DinJ toxin-antitoxin system

SCOPe Domain Sequences for d4ml0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ml0l_ d.298.1.0 (L:) automated matches {Escherichia coli [TaxId: 83333]}
qrdieysgqfskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqsswkgyrda
hvepdwiliykltdkllrfertgthaalfg

SCOPe Domain Coordinates for d4ml0l_:

Click to download the PDB-style file with coordinates for d4ml0l_.
(The format of our PDB-style files is described here.)

Timeline for d4ml0l_: