![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
![]() | Protein automated matches [190335] (3 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [259200] (1 PDB entry) |
![]() | Domain d4mjsg1: 4mjs G:15-100 [263024] Other proteins in same PDB: d4mjsa2, d4mjsc2, d4mjse2, d4mjsg2, d4mjsi2, d4mjsk2, d4mjsm2, d4mjso2, d4mjsq2, d4mjss2, d4mjsu2, d4mjsw2 automated match to d4mjsc_ complexed with edo |
PDB Entry: 4mjs (more details), 2.5 Å
SCOPe Domain Sequences for d4mjsg1:
Sequence, based on SEQRES records: (download)
>d4mjsg1 d.15.2.2 (G:15-100) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rvrlkahyggdilitsvdptttfqdlceevrdmcglhqqhpltlkwvdsegdpctvssqm eleeafrlacqgrdevliihvfpsip
>d4mjsg1 d.15.2.2 (G:15-100) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} rvrlkahyggdilitsvdtttfqdlceevrdmcglhqqhpltlkwvdsegdpctvssqme leeafrlacqgrdevliihvfpsip
Timeline for d4mjsg1: