| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Entamoeba histolytica [TaxId:885315] [259372] (1 PDB entry) |
| Domain d4mitc_: 4mit C: [263020] automated match to d1s8fb_ complexed with gtp, mg |
PDB Entry: 4mit (more details), 2.35 Å
SCOPe Domain Sequences for d4mitc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mitc_ c.37.1.0 (C:) automated matches {Entamoeba histolytica [TaxId: 885315]}
ekptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiqlalwdt
agleeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilvgtkld
trndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeavktvlm
n
Timeline for d4mitc_: