Lineage for d2pka.1 (2pka A:,B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793950Protein Kallikrein A [50555] (1 species)
  7. 1793951Species Pig (Sus scrofa) [TaxId:9823] [50556] (3 PDB entries)
  8. 1793952Domain d2pka.1: 2pka A:,B: [26302]
    complexed with ben

Details for d2pka.1

PDB Entry: 2pka (more details), 2.05 Å

PDB Description: refined 2 angstroms x-ray crystal structure of porcine pancreatic kallikrein a, a specific trypsin-like serine proteinase. crystallization, structure determination, crystallographic refinement, structure and its comparison with bovine trypsin
PDB Compounds: (A:) kallikrein a, (B:) kallikrein a

SCOPe Domain Sequences for d2pka.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2pka.1 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]}
iiggreceknshpwqvaiyhyssfqcggvlvnpkwvltaahckndnyevwlgrhnlfene
ntaqffgvtadfphpgfnlsXadgkdyshdlmllrlqspakitdavkvlelptqepelgs
tceasgwgsiepgpddfefpdeiqcvqltllqntfcadahpdkvtesmlcagylpggkdt
cmgdsggplicngmwqgitswghtpcgsankpsiytklifyldwiddtitenp

SCOPe Domain Coordinates for d2pka.1:

Click to download the PDB-style file with coordinates for d2pka.1.
(The format of our PDB-style files is described here.)

Timeline for d2pka.1: