Lineage for d4mitb_ (4mit B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871863Species Entamoeba histolytica [TaxId:885315] [259372] (1 PDB entry)
  8. 2871865Domain d4mitb_: 4mit B: [263019]
    automated match to d1s8fb_
    complexed with gtp, mg

Details for d4mitb_

PDB Entry: 4mit (more details), 2.35 Å

PDB Description: Crystal structure of E. histolytica RacC bound to the EhPAK4 PBD
PDB Compounds: (B:) Rho family GTPase

SCOPe Domain Sequences for d4mitb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mitb_ c.37.1.0 (B:) automated matches {Entamoeba histolytica [TaxId: 885315]}
ptsiklvvvgdgavgktcllisysirkfpedyiptvfdnyvvsltagtrqiqlalwdtag
leeydqlrplsyssasiflicfsvtssvsydnvitkwhpevihfapkvpiilvgtkldtr
ndpaivkrlteqgmtvintakgeelknrikavkyiecsaktsenlktvfdeavktvlmn

SCOPe Domain Coordinates for d4mitb_:

Click to download the PDB-style file with coordinates for d4mitb_.
(The format of our PDB-style files is described here.)

Timeline for d4mitb_: