SCOPe 2.05: Domain d4mika_: 4mik A:

Lineage for d4mika_ (4mik A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
   automatically mapped to Pfam PF01234

6. Protein automated matches [190168] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186895] (33 PDB entries)

8. Domain d4mika_: 4mik A: [263018]
   automated match to d2an3b_
   complexed with jil, trs

Details for d4mika_

PDB Entry: 4mik, 1.95 Å

PDB Description: crystal structure of hpnmt in complex with bisubstrate inhibitor (2r, 3r,4s,5s)-2-(6-amino-9h-purin-9-yl)-5-(((2-(((7-nitro-1,2,3,4- tetrahydroisoquinolin-3-yl)methyl)amino)ethyl)thio)methyl) tetrahydrofuran-3,4-diol

PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d4mika_:

Sequence; same for both SEQRES and ATOM records:

>d4mika_ c.66.1.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgptvy
qllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqdker
qlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhittll
rpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlqtg
vddvkgvffawaqkv

Timeline for d4mika_:

• d4mika_ is new in SCOPe 2.05-stable
  
• d4mika_ appears in SCOPe 2.06
  
• d4mika_ appears in the current release, SCOPe 2.08