Lineage for d4mhed_ (4mhe D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890825Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1890826Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1891154Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 1891155Protein automated matches [190775] (3 species)
    not a true protein
  7. 1891156Species Human (Homo sapiens) [TaxId:9606] [188003] (9 PDB entries)
  8. 1891168Domain d4mhed_: 4mhe D: [263016]
    automated match to d4mheb_
    complexed with act

Details for d4mhed_

PDB Entry: 4mhe (more details), 2.1 Å

PDB Description: crystal structure of cc-chemokine 18
PDB Compounds: (D:) C-C motif chemokine 18

SCOPe Domain Sequences for d4mhed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mhed_ d.9.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elcclvytswqipqkfivdysetspqcpkpgvilltkrgrqicadpnkkwvqkyisdlkl

SCOPe Domain Coordinates for d4mhed_:

Click to download the PDB-style file with coordinates for d4mhed_.
(The format of our PDB-style files is described here.)

Timeline for d4mhed_: